We cant download emails in thunderbird any version with mailboxes on exchange online O365. SMTP works fine. Receiving mails is not working and it gives Retr 21 error. … (læs mere)
We cant download emails in thunderbird any version with mailboxes on exchange online O365.
SMTP works fine. Receiving mails is not working and it gives Retr 21 error.
How to clear only site and download history without search history on Firefox 128. It was separate before the upgrade.
I want the same behaviour in the URL bar drop down as the search bar drop down, meaning that when I click a search engine, it immediately searches with it instead of doin… (læs mere)
I want the same behaviour in the URL bar drop down as the search bar drop down, meaning that when I click a search engine, it immediately searches with it instead of doing search suggestion queries. How can it be done in modern Firefox? The search bar should also have its own separate default search engine so you can immediately swap between 2 primary search engines without needing to select one from any drop down at all.
document text is full page but print preview and printed page shows text is much smaller. Selections made: A4 paper size . 'Fit to page width'
Sowing Answer and result my question and quarry
Sowing Answer and result my question and quarry
Sowing Answer and result my question and quarry
Firefox has long been my browser of choice on all platforms. I am switching from Windows to Linux and have recently found problems playing some videos on the Linux versio… (læs mere)
Firefox has long been my browser of choice on all platforms. I am switching from Windows to Linux and have recently found problems playing some videos on the Linux version of Foxfire. I don’t know if it’s a matter of having the right codec or something else. The videos play with Chromium on Linux and with Firefox on my Android smartphone. My Linux laptop is running version 128.0 of Firefox for Ubuntu version 24.0.0. Here are two offending links. https://www.youtube.com/watch?v=WkZuGil6U4w https://www.youtube.com/watch?v=HxVcDPtDnjM
Ffhjkkkkkkkkkhhhhgfddiddfurkeeykfmgcn88-09__⁶hyhhcggghhhhhjjhhhhhhhjjjjhhhhhhhhbhhhhhhhhhhhhhhhhhhhhhhhhhgflydymdyxmgkdtdtdoydyydodydtidtkdtkxtkxtkdtkxtxgkxyxkyxkydkydykd… (læs mere)
Ffhjkkkkkkkkkhhhhgfddiddfurkeeykfmgcn88-09__⁶hyhhcggghhhhhjjhhhhhhhjjjjhhhhhhhhbhhhhhhhhhhhhhhhhhhhhhhhhhgflydymdyxmgkdtdtdoydyydodydtidtkdtkxtkxtkdtkxtxgkxyxkyxkydkydykdyodydoyodyotdodtdotitdditditdtodtktdktddotkdtkxykxyfypydpodyxylxyllxyxyldylxyllxyxyldtkkxtlgxhxlxylxylxygx Hal eciwxgigiwgixwgigdiwdcdigwdiwdidgwdwgixwihfwgixdgigiifhwcihwcwihcicwhichicwihciwhfwhifwhicihcichiwhichwciwcihwcywcwcuwciwihcucwhwcuwgveburusbsyyktskktstsktsktsktstsktsktskktsydkydkkydakydalydlydwfkyskfysfykskfysylsfylfslyfylfsfyllyffieiiheihcephechihfiefhifihfihhifehheicihchicehicehcrhechccshchcicichcipcipxuhpsxjxpipxhxupsuhpxjhpxjhpxxjpxjhpxjhpscihpxwigwxivxwsiheciscchiscihdchipihcsihcishcsicdihecidicpdigcpividigvdihpichdivhidhvdivhdi hdh d hei hei hd sh eh dih dhvdvhdivhidhvdchdivhdivhecheivhechevevehvhevieivhiishi sh Gie shidgivs givgsi sgi diggveieviviheggeicgecipgivepigcspvsigsivgsupg sih di dgigi dgid guvds gups guug spig spigps gupscugscigs ih sgid ugs UPS ugps Gus i
I am unable to connect to kp.org what to do?
I used to be able to press Enter in the empty Firefox search bar to bring up the (DuckDuckGo) search page and enter my search from there. Don't ask me why I like doing th… (læs mere)
I used to be able to press Enter in the empty Firefox search bar to bring up the (DuckDuckGo) search page and enter my search from there. Don't ask me why I like doing that, but now after the latest Firefox update, 128.0, on my MacBook Air I can't do that anymore. I have to type in the search bar to bring up the search page.
I know it's a small thing but I wonder if it can be put back to the way it used to be.
Is there anyway to automate and set default 'Format' 'Textstyle 'Superscript for dates eg 1st to 1st, 2nd to 2nd, 3rd to 3rd? Please have a look at the attached image Som… (læs mere)
Is there anyway to automate and set default 'Format' 'Textstyle 'Superscript for dates eg 1st to 1st, 2nd to 2nd, 3rd to 3rd? Please have a look at the attached image Some Word-processors do this. Many thanks Derek
Firefox Browser: When the cache size is around or over 1GB, then the browser starts experiencing issues. Primarily, it has difficulty loading webpages. Current So… (læs mere)
Firefox Browser: When the cache size is around or over 1GB, then the browser starts experiencing issues. Primarily, it has difficulty loading webpages.
Current Solution: 01. I stop Firefox browser. 02. Delete browser cache. 03. Restart browser (and browser works - until cache size gets to around 1GB again).
Is this a bug?
Android 11 Moto G Stylus (XT2115DL)
In firefox nightly the browser.urlbar.trimURLs option seems to be ignored, and it is showing only the domain name. It would be much safer to see the full long string. Is … (læs mere)
In firefox nightly the browser.urlbar.trimURLs option seems to be ignored, and it is showing only the domain name. It would be much safer to see the full long string. Is it possible to observe the full url?
If you fix it ill willingly fix my rating on google play because i thought mozilla was better than chrome but then i need to open the side bar for it to redirect to whats… (læs mere)
If you fix it ill willingly fix my rating on google play because i thought mozilla was better than chrome but then i need to open the side bar for it to redirect to whatsapp otherwise it wont help[a bit and you'll se a whatsapp icon]
Got a new PC and loading all the software (ugh). I made Firefox my default browser and opened my Yahoo email. I tried synching the bookmarks and picked Sync Now but the… (læs mere)
Got a new PC and loading all the software (ugh). I made Firefox my default browser and opened my Yahoo email. I tried synching the bookmarks and picked Sync Now but the old bookmarks are not showing up. I still have a laptop with all the old bookmarks (from synching automatically). Can I export those to a thumb drive and bring into the new computer somehow? Do I risk losing my bookmarks on the laptop when I turn it on? Fred
For the testing I use the old proof of concept: https://www.xn--80ak6aa92e.com/ And the browser is showing apple.com I have network.IDN_show_punycode switched to true. … (læs mere)
For the testing I use the old proof of concept: https://www.xn--80ak6aa92e.com/
And the browser is showing apple.com
I have network.IDN_show_punycode switched to true.
When I click on most links in emails and even in the browser, google they don't work
My app was working fine yesterday but today nothing. I've reinstalled and same issue. The phone is getting a signal and has working internet. What's going on?
I am using Firefox nightly on Android. About two weeks ago I noticed that my toolbar got moved to the bottom after some update, while address bar is still at the top. I t… (læs mere)
I am using Firefox nightly on Android. About two weeks ago I noticed that my toolbar got moved to the bottom after some update, while address bar is still at the top. I tried looking for it in settings but couldn't find anything about toolbar, that's weird since I was able to customize it a few years ago when I installed Firefox for the first time. So I looked it up on the internet and they say that it's in Settings/Customize/Toolbar, but in my browser settings instead of Toolbar there is Address bar settings. Has toolbar's settings been moved somewhere else? It looks like in previous versions it was under Customize section.
The second attached image is from this video:
https://m.youtube.com/watch?v=20JU-KJL6rk