Firefox Androidile Community Forum

Ffhjkkkkkkkkkhhhhgfddiddfurkeeykfmgcn88-09__⁶hyhhcggghhhhhjjhhhhhhhjjjjhhhhhhhhbhhhhhhhhhhhhhhhhhhhhhhhhhgflydymdyxmgkdtdtdoydyydodydtidtkdtkxtkxtkdtkxtxgkxyxkyxkydkydykdyodydoyodyotdodtdotitdditditdtodtktdktddotkdtkxykxyfypydpodyxylxyllxyxyldylxyllxyxyldtkkxtlgxhxlxylxylxygx Hal eciwxgigiwgixwgigdiwdcdigwdiwdidgwdwgixwihfwgixdgigiifhwcihwcwihcicwhichicwihciwhfwhifwhicihcichiwhichwciwcihwcywcwcuwciwihcucwhwcuwgveburusbsyyktskktstsktsktsktstsktsktskktsydkydkkydakydalydlydwfkyskfysfykskfysylsfylfslyfylfsfyllyffieiiheihcephechihfiefhifihfihhifehheicihchicehicehcrhechccshchcicichcipcipxuhpsxjxpipxhxupsuhpxjhpxjhpxxjpxjhpxjhpscihpxwigwxivxwsiheciscchiscihdchipihcsihcishcsicdihecidicpdigcpividigvdihpichdivhidhvdivhdi hdh d hei hei hd sh eh dih dhvdvhdivhidhvdchdivhdivhecheivhechevevehvhevieivhiishi sh Gie shidgivs givgsi sgi diggveieviviheggeicgecipgivepigcspvsigsivgsupg sih di dgigi dgid guvds gups guug spig spigps gupscugscigs ih sgid ugs UPS ugps Gus i

Firefox Browser: When the cache size is around or over 1GB, then the browser starts experiencing issues. Primarily, it has difficulty loading webpages.

Current Solution: 01. I stop Firefox browser. 02. Delete browser cache. 03. Restart browser (and browser works - until cache size gets to around 1GB again).

Is this a bug?

Android 11 Moto G Stylus (XT2115DL)

In firefox nightly the browser.urlbar.trimURLs option seems to be ignored, and it is showing only the domain name. It would be much safer to see the full long string. Is it possible to observe the full url?

If you fix it ill willingly fix my rating on google play because i thought mozilla was better than chrome but then i need to open the side bar for it to redirect to whatsapp otherwise it wont help[a bit and you'll se a whatsapp icon]

For the testing I use the old proof of concept: https://www.xn--80ak6aa92e.com/

And the browser is showing apple.com

I have network.IDN_show_punycode switched to true.

I am using Firefox nightly on Android. About two weeks ago I noticed that my toolbar got moved to the bottom after some update, while address bar is still at the top. I tried looking for it in settings but couldn't find anything about toolbar, that's weird since I was able to customize it a few years ago when I installed Firefox for the first time. So I looked it up on the internet and they say that it's in Settings/Customize/Toolbar, but in my browser settings instead of Toolbar there is Address bar settings. Has toolbar's settings been moved somewhere else? It looks like in previous versions it was under Customize section.

The second attached image is from this video:

https://m.youtube.com/watch?v=20JU-KJL6rk

Hi there I have this problem for 2 years now I have been targeted for money so I been hacked in Adchoices in third party so I have been blocked from lots of companies and my identity has been compromised my Facebook, istagram all my photos gone it's very hard for me can you give me advice please, Sylvia Bogdanov 0431904724 thanks 😊

As of today in Firefox Nightly for Android the buttons noted in the subject line above have now taken up a section of my screen instead of being tucked away in a menu, which is my preference. I cannot figure out how to put it back as I have no need for these to be persistent in any way. Please instruct me on how to reassert the previous settings.

Navigation bar in latest nightly (130.0a1) is split into two toolbars, this cannot be customized.

This help article is not applicable anymore https://support.mozilla.org/en-US/kb/move-navigation-bar